Structure of PDB 7oqc Chain A

Receptor sequence

>7oqcA (length=132) Species: 4932 (Saccharomyces cerevisiae)

SALYFQNLPSRPANKENYTRLLLKHINPNNKYAINPSLPLPHNKLLLDDQ
MGLLEVSISRSSKMTNQAFLTFVTQEEADRFLEKYTTTALKVQGRKVRMG
KARTNSLLGLSIEMQKYNLDIKKVLKARKLKR

3D structure

• PDB: 7oqc Structural insights into how Prp5 proofreads the pre-mRNA branch site.
• Chain: A
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y5 Q7 R12 A14 N15 K16 N18 H43 E64 S66 I67 S68 R69 K72 F78 Q102 G103 R104 K105 R107 A111 N114 L116 D136 I137 K138 K139	Y4 Q6 R11 A13 N14 K15 N17 H42 E55 S57 I58 S59 R60 K63 F69 Q93 G94 R95 K96 R98 A102 N105 L107 D120 I121 K122 K123

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030619 U1 snRNA binding

Biological Process

• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0071004 U2-type prespliceosome

External links

• PDB: RCSB:7oqc, PDBe:7oqc, PDBj:7oqc
• PDBsum: 7oqc
• PubMed: 34349264
• UniProt: P32605|RU1A_YEAST U1 small nuclear ribonucleoprotein A (Gene Name=MUD1)