Structure of PDB 7opr Chain A

Receptor sequence

>7oprA (length=218) Species: 9606 (Homo sapiens)

HMSFLTEEEQEAIMKVLQRDAALKRAEEERGSDGDYDYLIKFLALGDSGV
GKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL
QLWDTAGLERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH
AYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNI
SQAIEMLLDLIMKRMERS

3D structure

• PDB: 7opr Identification of the first structurally validated covalent ligands of the small GTPase RAB27A.
• Chain: A
• Resolution: 2.32 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	A	S18 G19 G21 K22 T23 S24 F34 S36 F38 T40 T41 G77 N133 K134 D136 L137 S163 A164	S48 G49 G51 K52 T53 S54 F64 S66 F68 T70 T71 G107 N163 K164 D166 L167 S193 A194
BS02	MG	A	T23 T41	T53 T71
BS03	05Y	A	K11 R90 D91 A92 M93 Y122 C123 I181 R184 M185	K41 R120 D121 A122 M123 Y152 C153 I211 R214 M215

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0031267 small GTPase binding

Biological Process

• GO:0006886 intracellular protein transport

External links

• PDB: RCSB:7opr, PDBe:7opr, PDBj:7opr
• PDBsum: 7opr
• PubMed: 35308027
• UniProt: P51159|RB27A_HUMAN Ras-related protein Rab-27A (Gene Name=RAB27A);
  Q9HCH5