Structure of PDB 7ohs Chain A

Receptor sequence
>7ohsA (length=142) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MNKQRTLSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTLQQLNEIAELYNC
NNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQGSRPVLSFDQRFESSPHY
QLIKELLVHNFGVPPNARKSKPFIDHVMSFSIVDDKIWVRTY
3D structure
PDB7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
ChainA
Resolution4.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A R39 G40 V41 N42 Y43 R44 H45 A91 R92 K93 H94 Q95 D96 R9 G10 V11 N12 Y13 R14 H15 A58 R59 K60 H61 Q62 D63
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000464 endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
PDBsum7ohs
PubMed34813592
UniProtQ08235|BRX1_YEAST Ribosome biogenesis protein BRX1 (Gene Name=BRX1)

[Back to BioLiP]