Structure of PDB 7ody Chain A

Receptor sequence
>7odyA (length=99) Species: 260586 (Cyanophage S-2L) [Search protein sequence]
PATVAELQAEIAAWIHPLNPDRRPGGTIAKLLEEIGELIASDRDPLEVAD
VLILALDLATLLGVDVTEAIRAKLAINRARSWARADNGAMRHIPGSDTP
3D structure
PDB7ody Characterization of a triad of genes in cyanophage S-2L sufficient to replace adenine by 2-aminoadenine in bacterial DNA.
ChainA
Resolution1.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.9: nucleotide diphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DGI A I16 K31 E35 E38 D53 L57 D60 I15 K30 E34 E37 D50 L54 D57
BS02 MN A E35 E38 E50 D53 E34 E37 E47 D50
BS03 MN A E34 E35 E38 E33 E34 E37
BS04 MN A E38 E50 E37 E47
BS05 DGI A K76 R83 W85 A92 M93 R94 H95 K73 R80 W82 A89 M90 R91 H92
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:7ody, PDBe:7ody, PDBj:7ody
PDBsum7ody
PubMed34354070
UniProtA0A7U3TBV3|DGTPH_BPS2L dATP/dGTP diphosphohydrolase (Gene Name=S2L_23)

[Back to BioLiP]