Structure of PDB 7odu Chain A |
>7oduA (length=129) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
ITGYAACPRNWIGVGNKCFYFSEYASNWTFSQTFCKAQEAELARFDTEEE LNFLSRYKGSFDYWIGLHRESSEHPWKWTDNTQYNYSLSIRGVERYAYLN DIGISSARVYADKRWSCSRLNSGTHHHHH |
|
PDB | 7odu Production of recombinant soluble dimeric C-type lectin-like receptors of rat natural killer cells |
Chain | A |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E112 H198 H200 |
E39 H125 H127 |
|
|
|