Structure of PDB 7o90 Chain A |
>7o90A (length=141) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search protein sequence] |
DLKGTKTAENLKQGFIGESMANRRYLYFAKRADEEGYPEIAGLLRSIAEG ETAHAFGHLDFIRQGGLTDPATDKPIGTLEQMIESAIAGETYEWTQMYPG FAKVAREEGFPEVAEWFETLARAEKSHAEKFQNVLKQLKGG |
|
PDB | 7o90 Bimetallic Mn, Fe, Co, and Ni Sites in a Four-Helix Bundle Protein: Metal Binding, Structure, and Peroxide Activation. |
Chain | A |
Resolution | 1.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
E92 E126 H129 |
E90 E124 H127 |
|
|
|
|