Structure of PDB 7o4k Chain A

Receptor sequence
>7o4kA (length=167) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SSAPLRTVKEVQFGLFSPEEVRAISVECPGHFIKKVCECVCMHCGKLLLC
KTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRDEP
ELRVLSTEEILNIFKHISVFLETLEHNGAPHHAIEQSEETAELDDILGQM
TGAFDVMIDEESLVKYM
3D structure
PDB7o4k Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
ChainA
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E495 E496 D1442 V1443 M1444 D1446 L1450 Y1453 M1454 E138 E139 D155 V156 M157 D159 L163 Y166 M167
BS02 ZN A C107 C110 C148 C41 C44 C56
Gene Ontology
Molecular Function
GO:0001055 RNA polymerase II activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016779 nucleotidyltransferase activity
GO:0034062 5'-3' RNA polymerase activity
GO:0046872 metal ion binding
Biological Process
GO:0001172 RNA-templated transcription
GO:0006351 DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0019985 translesion synthesis
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex
GO:0005739 mitochondrion
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o4k, PDBe:7o4k, PDBj:7o4k
PDBsum7o4k
PubMed34133942
UniProtP04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 (Gene Name=RPO21)

[Back to BioLiP]