Structure of PDB 7nuh Chain A

Receptor sequence

>7nuhA (length=180) Species: 641809 (Influenza A virus (A/California/07/2009(H1N1)))

SGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFM
YSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENR
FIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE
SRARIKTRLFTIRQEMASRSLWDSFRQSER

3D structure

• PDB: 7nuh Synthesis and In Vitro Evaluation of C-7 and C-8 Luteolin Derivatives as Influenza Endonuclease Inhibitors.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H44 D92 E103 I104
BS02	MN	A	E80 D108	E64 D92
BS03	MG	A	E80 D108	E64 D92
BS04	USE	A	A20 M21 Y24 E26 K34 H41 E80 D108 E119 K134	A23 M24 Y27 E29 K37 H44 E64 D92 E103 K118

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:7nuh, PDBe:7nuh, PDBj:7nuh
• PDBsum: 7nuh
• PubMed: 34299354
• UniProt: C3W5X6