Structure of PDB 7nrw Chain A |
>7nrwA (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
GMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDI ITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWD GKETTIKRKLVNGKTVAECKMKGVVCTRIYEKV |
|
PDB | 7nrw Human myelin protein P2: from crystallography to time-lapse membrane imaging and neuropathy-associated variants. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
N16 D19 |
N17 D20 |
|
|
|
|