Structure of PDB 7nnv Chain A

Receptor sequence

>7nnvA (length=308) Species: 83332 (Mycobacterium tuberculosis H37Rv)

SVIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKN
STRTRFSFELGIAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIV
WRTFGQERLDAMASVATVPVINALSDEFHPCQVLADLQTIAERKGALRGL
RLSYFGDGANNMAHSLLLGGVTAGIHVTVAAPEGFLPDPSVRAAAERRAQ
DTGASVTVTADAHAAAAGADVLVTDTWTSMGQENDGLDRVKPFRPFQLNS
RLLALADSDAIVLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKAL
LVWLLERS

3D structure

• PDB: 7nnv A fragment-based approach to assess the ligandability of ArgB, ArgC, ArgD and ArgF in the L-arginine biosynthetic pathway of Mycobacterium tuberculosis
• Chain: A
• Resolution: 1.67 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R101 H128 Q131 D224 C264 R292
• Catalytic site (residue number reindexed from 1): R102 H129 Q132 D225 C265 R293
• Enzyme Commision number: 2.1.3.3: ornithine carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CP	A	S50 T51 R52 T53 R101 H128 C264 L265 R292	S51 T52 R53 T54 R102 H129 C265 L266 R293

Gene Ontology

Molecular Function

• GO:0004585 ornithine carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006526 L-arginine biosynthetic process
• GO:0006591 ornithine metabolic process
• GO:0019240 citrulline biosynthetic process
• GO:0042450 arginine biosynthetic process via ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7nnv, PDBe:7nnv, PDBj:7nnv
• PDBsum: 7nnv
• UniProt: P9WIT9|OTC_MYCTU Ornithine carbamoyltransferase (Gene Name=argF)