Structure of PDB 7nkz Chain A

Receptor sequence

>7nkzA (length=455) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

MNVVDISRWQFGITTVYHFIFVPLTIGLAPLIAVMQTLWVVTDNPAWYRL
TKFFGKLFLINFAIGVATGIVQEFQFGMNWSEYSRFVGDVFGAPLAMEGL
AAFFFESTFIGLWIFGWNRLPRLVHLACIWIVAIAVNVSAFFIIAANSFM
QHPVGAHYNPTTGRAELSSIVVLLTNNTAQAAFTHTVSGALLTAGTFVAA
VSAWWLVRSSTDTQAMYRPATILGCWVALAATAGLLFTGDHQGKLMFQQQ
PMKMASAESLCDTQTDPNFSVLTVGRQNNCDSLTRVIEVPYVLPFLAEGR
ISGVTLQGIRDLQQEYQQRFGPNDYRPNLFVTYWSFRMMIGLMAIPVLFA
LIALWLTRGGQIPNQRWFSWLALLTMPAPFLANSAGWVFTEMGRQPWVVV
PNPTGDQLVRLTVKAGVSDHSATVVATSLLMFTLVYAVLAVIWCWLLKRY
IVEGP

3D structure

PDB

7nkz The cryo-EM structure of the bd oxidase from M. tuberculosis reveals a unique structural framework and enables rational drug design to combat TB.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OXY	A	E98 F103 I143	E98 F103 I143
BS02	MQ9	A	R8 W9 Y17 I20 V336 W339 S340 R342 M343 G346 S389 A390 M397	R8 W9 Y17 I20 V331 W334 S335 R337 M338 G341 S384 A385 M392
BS03	HDD	A	H18 V22 I26 F62 V66 G69 Q72 E73 F76 F103 E106 S107 S139 A140 I143	H18 V22 I26 F62 V66 G69 Q72 E73 F76 F103 E106 S107 S139 A140 I143
BS04	HEB	A	R8 F11 G12 T15 F19 F76 W80 Y83 F91 I143 N147 M150 W392 E396 M397 R399 Q400 V403 V418	R8 F11 G12 T15 F19 F76 W80 Y83 F91 I143 N147 M150 W387 E391 M392 R394 Q395 V398 V413
BS05	HEB	A	A182 H185 G189 L240 Q247 G248 K258 M344 I345 M348 A387 N388 G391 W392 F394 T395	A182 H185 G189 L235 Q242 G243 K253 M339 I340 M343 A382 N383 G386 W387 F389 T390

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0019646	aerobic electron transport chain

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0070069	cytochrome complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nkz, PDBe:7nkz, PDBj:7nkz
PDBsum	7nkz
PubMed	34475399
UniProt	L7N662

[Back to BioLiP]