Structure of PDB 7nga Chain A

Receptor sequence

>7ngaA (length=650) Species: 10090 (Mus musculus)

ELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQAS
ESGKVIVLVNKVMLAEQLFRKEFNPYLKKWYRIIGLSGDTQLKISFPEVV
KSYDVIISTAQILENSLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVY
NNIMRRYLKQKLRNNDLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEK
HILNICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIANPFKEKLLEIMA
SIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNE
ALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNLDETDEFLMNLFFDNKK
MLKKLAENPKEKLIKLRNTILEQFTRSESRGIIFTKTRQSTYALSQWIME
NAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLIATT
VAEEGLDIKECNIVIRYGLVTARADESTYVLVTREIVNDFREKMMYKAIN
RVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNPSLITLLCKN
CSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKNGEIICKCGQAWGT
MMVHKGLDLPCLKIRNFVVNFKNNSPKKQYKKWVELPIRFPDLDYSEYCL

3D structure

• PDB: 7nga MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
• Chain: A
• Resolution: 3.9 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K451 E452 H578 Q581 T769 R843 H927 R985 K1002	K146 E147 H268 Q271 T429 R484 H568 R615 K632
BS02	rna	A	N365 V367 G393 Q416 I417 I584 K588 K726 T727 R728 G756 S761 T789 T790 E924 H974 K1001	N60 V62 G88 Q111 I112 I274 K278 K386 T387 R388 G416 S421 T449 T450 E565 H604 K631
BS03	ZN	A	C907 C962 C964	C548 C592 C594
BS04	ADP	A	Q308 L309 R310 Q313 G333 G335 K336 T337 R338	Q3 L4 R5 Q8 G28 G30 K31 T32 R33

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003724 RNA helicase activity
• GO:0003725 double-stranded RNA binding
• GO:0003727 single-stranded RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0019904 protein domain specific binding
• GO:0038187 pattern recognition receptor activity
• GO:0042802 identical protein binding
• GO:0043021 ribonucleoprotein complex binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002376 immune system process
• GO:0009615 response to virus
• GO:0016925 protein sumoylation
• GO:0032727 positive regulation of interferon-alpha production
• GO:0032728 positive regulation of interferon-beta production
• GO:0032755 positive regulation of interleukin-6 production
• GO:0032760 positive regulation of tumor necrosis factor production
• GO:0039530 MDA-5 signaling pathway
• GO:0045071 negative regulation of viral genome replication
• GO:0045087 innate immune response
• GO:0051259 protein complex oligomerization
• GO:0051607 defense response to virus
• GO:0060337 type I interferon-mediated signaling pathway
• GO:0060760 positive regulation of response to cytokine stimulus
• GO:0071360 cellular response to exogenous dsRNA
• GO:0098586 cellular response to virus
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:7nga, PDBe:7nga, PDBj:7nga
• PDBsum: 7nga
• PubMed: 34795277
• UniProt: Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 (Gene Name=Ifih1)