Structure of PDB 7n8n Chain A

Receptor sequence
>7n8nA (length=197) Species: 1560514 (Melbournevirus) [Search protein sequence]
DHVSVGETQIPKASTQHLLRKAGSLSAAGDTEVPIRGFVHMKLHKLVQKS
LLAMQLAKRKTIMKSDVKKAAELMHLPVFAIPTKDSGAKGSVFLSCRQKG
AGSAGTGSETNSQEVRSQMKSTCLIIPKERFRTMAKEISKKEGHDVHIAE
AALDMLQVIVESCTVRLLEKALVITYSGKRTRVTSKDIETAFMLEHG
3D structure
PDB7n8n Virus-encoded histone doublets are essential and form nucleosome-like structures.
ChainA
Resolution3.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P34 K81 K112 F116 L117 R155 K159 H170 I171 E173 R203 T204 R205 P11 K58 K89 F93 L94 R132 K136 H147 I148 E150 R180 T181 R182
BS02 dna A R43 S49 A50 G52 R82 K83 T84 R120 P150 K151 E152 R153 K202 R205 R20 S26 A27 G29 R59 K60 T61 R97 P127 K128 E129 R130 K179 R182
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0000786 nucleosome
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7n8n, PDBe:7n8n, PDBj:7n8n
PDBsum7n8n
PubMed34297924
UniProtA0A097I2D0|H4H3_MELV Histone doublet H4-H3 (Gene Name=MEL_368)

[Back to BioLiP]