Structure of PDB 7n73 Chain A

Receptor sequence

>7n73A (length=1036) Species: 9606 (Homo sapiens)

SVRLSGYCGSPWRVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLA
HAETLVIEIWQLFTVQVQTEVLRYYLFQGQRYIWIETQQAFYQVSLLDHG
RSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPYY
GFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLRDMVKL
SMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVN
ESSLTGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHV
LAVVTRTGFCTAKGGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTI
YSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQ
GIFCIHPLRINLGGKLQLVCFDKTGTLTEDGLDVMGVVPLKGQAFLPLVP
EPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVESTGWVLEDSAFG
TQVPVPVSVLHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELVAGLCN
PETVPTDFAQMLQSYTAAGYRVVALASKPLPTVPSLEAAQQLTRDTVEGD
LSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCG
MVAPQEHLIIVHATHPERGQPASLEFLPMESRSRHLALSGPTFGIIVKHF
PKLLPKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALK
AADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFKYM
ALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVL
GRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVA
APDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALAL
LSSVLVGLVLVPGLLQGPLALRNITDTGFKLLLLGLVTLNFVGAFMLESV
LDQCLPACLRRLRPKRASKKRFKQLERELAEQPWPP

3D structure

• PDB: 7n73 Structural basis of polyamine transport by human ATP13A2 (PARK9).
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 7.6.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	T510 D566 M568 D569 F625 S627 Q630 M632 K649 R681 V683 G746 D747 R848 N876	T424 D480 M482 D483 F515 S517 Q520 M522 K539 R571 V573 G636 D637 R716 N744
BS02	ALF	A	D508 K509 T510 T745 G746 K854 N876	D422 K423 T424 T635 G636 K722 N744
BS03	MG	A	D508 T510 D873	D422 T424 D741
BS04	Y01	A	L268 Y478 R484 L963 V971	L182 Y392 R398 L831 V839
BS05	Y01	A	T968 L1082	T836 L950

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005215 transporter activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008270 zinc ion binding
• GO:0008289 lipid binding
• GO:0015203 polyamine transmembrane transporter activity
• GO:0015417 ABC-type polyamine transporter activity
• GO:0015662 P-type ion transporter activity
• GO:0016887 ATP hydrolysis activity
• GO:0019829 ATPase-coupled monoatomic cation transmembrane transporter activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding
• GO:0070300 phosphatidic acid binding
• GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
• GO:0140358 P-type transmembrane transporter activity
• GO:1903135 cupric ion binding

Biological Process

• GO:0006874 intracellular calcium ion homeostasis
• GO:0006879 intracellular iron ion homeostasis
• GO:0006882 intracellular zinc ion homeostasis
• GO:0006914 autophagy
• GO:0007041 lysosomal transport
• GO:0010628 positive regulation of gene expression
• GO:0010821 regulation of mitochondrion organization
• GO:0016241 regulation of macroautophagy
• GO:0016243 regulation of autophagosome size
• GO:0030003 intracellular monoatomic cation homeostasis
• GO:0033157 regulation of intracellular protein transport
• GO:0034220 monoatomic ion transmembrane transport
• GO:0034599 cellular response to oxidative stress
• GO:0043523 regulation of neuron apoptotic process
• GO:0046777 protein autophosphorylation
• GO:0050714 positive regulation of protein secretion
• GO:0052548 regulation of endopeptidase activity
• GO:0055085 transmembrane transport
• GO:0055088 lipid homeostasis
• GO:0061462 protein localization to lysosome
• GO:0061909 autophagosome-lysosome fusion
• GO:0071287 cellular response to manganese ion
• GO:0071294 cellular response to zinc ion
• GO:0097734 extracellular exosome biogenesis
• GO:0098655 monoatomic cation transmembrane transport
• GO:1900180 regulation of protein localization to nucleus
• GO:1902047 polyamine transmembrane transport
• GO:1903146 regulation of autophagy of mitochondrion
• GO:1903543 positive regulation of exosomal secretion
• GO:1903710 spermine transmembrane transport
• GO:1904714 regulation of chaperone-mediated autophagy
• GO:1905037 autophagosome organization
• GO:1905123 regulation of glucosylceramidase activity
• GO:1905165 regulation of lysosomal protein catabolic process
• GO:1905166 negative regulation of lysosomal protein catabolic process
• GO:1990938 peptidyl-aspartic acid autophosphorylation
• GO:2000152 regulation of ubiquitin-specific protease activity

Cellular Component

• GO:0000421 autophagosome membrane
• GO:0005764 lysosome
• GO:0005765 lysosomal membrane
• GO:0005768 endosome
• GO:0005770 late endosome
• GO:0005771 multivesicular body
• GO:0005776 autophagosome
• GO:0012506 vesicle membrane
• GO:0016020 membrane
• GO:0030133 transport vesicle
• GO:0031902 late endosome membrane
• GO:0031982 vesicle
• GO:0032585 multivesicular body membrane
• GO:0043005 neuron projection
• GO:0043025 neuronal cell body
• GO:0043202 lysosomal lumen

External links

• PDB: RCSB:7n73, PDBe:7n73, PDBj:7n73
• PDBsum: 7n73
• PubMed: 34715013
• UniProt: Q9NQ11|AT132_HUMAN Polyamine-transporting ATPase 13A2 (Gene Name=ATP13A2)