Structure of PDB 7n5s Chain A

Receptor sequence

>7n5sA (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]

FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN

3D structure

PDB

7n5s Structural basis for human ZBTB7A action at the fetal globin promoter.

Chain

Resolution

2.86 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	K389 I391 Q392 K396 R399 H400 T403 R421 R458 R464 R477 R483	K9 I11 Q12 K16 R19 H20 T23 R41 R78 R84 R97 R103
BS02	dna	A	G395 Q422 D423 K426 R430 Y438 N450 S478 D479 H482	G15 Q42 D43 K46 R50 Y58 N70 S98 D99 H102
BS03	ZN	A	C412 C415 H428 H432	C32 C35 H48 H52
BS04	ZN	A	C384 C387 H400 H404	C4 C7 H20 H24
BS05	ZN	A	C440 C443 H456 H460	C60 C63 H76 H80
BS06	ZN	A	C468 C471 H484 C490	C88 C91 H104 C110

External links

PDB	RCSB:7n5s, PDBe:7n5s, PDBj:7n5s
PDBsum	7n5s
PubMed	34592153
UniProt	O95365\|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)