Structure of PDB 7n3l Chain A

Receptor sequence

>7n3lA (length=434) Species: 9606 (Homo sapiens) [Search protein sequence]

SRYEHIPGPPGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKF
LMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFS
RSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAA
FGMETSMLLGAQKPLSQAVKLMLEGITASRKRKQLREVRESIRFLRQVGR
DWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHE
TSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQ
VLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYF
EDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLL
QRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPR

3D structure

PDB

7n3l Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.

Chain

Resolution

1.631 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.14.25: cholesterol 24-hydroxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	K104 Y109 L125 V126 W134 R138 A302 G303 T306 A367 T370 P429 F430 S431 R435 C437 I438 G439 A443	K58 Y63 L79 V80 W88 R92 A247 G248 T251 A312 T315 P374 F375 S376 R380 C382 I383 G384 A388
BS02	04Y	A	F80 M108 Y109 L112 F121 R226 I301 A302 E305 T306 F371 T475	F34 M62 Y63 L66 F75 R180 I246 A247 E250 T251 F316 T420

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0008395	steroid hydroxylase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037	heme binding
GO:0033781	cholesterol 24-hydroxylase activity
GO:0046872	metal ion binding
GO:0062184	testosterone 16-beta-hydroxylase activity

	Biological Process
GO:0006699	bile acid biosynthetic process
GO:0006707	cholesterol catabolic process
GO:0006805	xenobiotic metabolic process
GO:0007399	nervous system development
GO:0008203	cholesterol metabolic process
GO:0008207	C21-steroid hormone metabolic process
GO:0016125	sterol metabolic process
GO:0042448	progesterone metabolic process
GO:1900271	regulation of long-term synaptic potentiation
GO:1903044	protein localization to membrane raft

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0030425	dendrite
GO:0042995	cell projection
GO:0045202	synapse
GO:0098793	presynapse
GO:0098794	postsynapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7n3l, PDBe:7n3l, PDBj:7n3l
PDBsum	7n3l
PubMed	35166541
UniProt	Q9Y6A2\|CP46A_HUMAN Cholesterol 24-hydroxylase (Gene Name=CYP46A1)

[Back to BioLiP]