Structure of PDB 7n10 Chain A |
>7n10A (length=60) Species: 198466 (Streptococcus pyogenes MGAS315) [Search protein sequence] |
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVER VEEVMVELDK |
|
PDB | 7n10 Molecular mechanism of quorum sensing inhibition in Streptococcus by the phage protein paratox. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
D12 K13 G14 Y15 |
D12 K13 G14 Y15 |
|
|
|