Structure of PDB 7ms3 Chain A |
>7ms3A (length=144) Species: 1718 (Corynebacterium glutamicum) [Search protein sequence] |
PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDS YFIAAQSASENHIWVQATIRSGATEKQKEELLLRLTQEIALILGIPNEEV WVYITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELE |
|
PDB | 7ms3 Cg10062 Catalysis Forges a Link between Acetylenecarboxylic Acid and Bacterial Metabolism. |
Chain | A |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3OH |
A |
P1 H28 I69 E114 |
P1 H28 I69 E114 |
|
|
|