Structure of PDB 7mo3 Chain A

Receptor sequence

>7mo3A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence]

PQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNR
GPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHR
DLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYN
FEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQT
TALP

3D structure

PDB

7mo3 Architecture of the cytoplasmic face of the nuclear pore.

Chain

Resolution

2.05 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	G20 T21 G22 K23 T24 T25 N122 K123 D125 I126 S150 K152	G14 T15 G16 K17 T18 T19 N116 K117 D119 I120 S144 K146

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003682	chromatin binding
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005049	nuclear export signal receptor activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0019904	protein domain specific binding
GO:0044877	protein-containing complex binding
GO:0045296	cadherin binding
GO:0045505	dynein intermediate chain binding
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity
GO:0061676	importin-alpha family protein binding
GO:0070883	pre-miRNA binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000055	ribosomal large subunit export from nucleus
GO:0000056	ribosomal small subunit export from nucleus
GO:0000070	mitotic sister chromatid segregation
GO:0000278	mitotic cell cycle
GO:0006259	DNA metabolic process
GO:0006606	protein import into nucleus
GO:0006611	protein export from nucleus
GO:0006913	nucleocytoplasmic transport
GO:0007052	mitotic spindle organization
GO:0007286	spermatid development
GO:0008104	protein localization
GO:0014070	response to organic cyclic compound
GO:0015031	protein transport
GO:0016032	viral process
GO:0021766	hippocampus development
GO:0030036	actin cytoskeleton organization
GO:0031503	protein-containing complex localization
GO:0032092	positive regulation of protein binding
GO:0035281	pre-miRNA export from nucleus
GO:0042307	positive regulation of protein import into nucleus
GO:0046039	GTP metabolic process
GO:0051301	cell division
GO:0061015	snRNA import into nucleus
GO:0071389	cellular response to mineralocorticoid stimulus
GO:1902570	protein localization to nucleolus

	Cellular Component
GO:0000785	chromatin
GO:0001673	male germ cell nucleus
GO:0002177	manchette
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005814	centriole
GO:0005829	cytosol
GO:0016020	membrane
GO:0030496	midbody
GO:0032991	protein-containing complex
GO:0036126	sperm flagellum
GO:0042470	melanosome
GO:0042565	RNA nuclear export complex
GO:0055037	recycling endosome
GO:0070062	extracellular exosome
GO:0090543	Flemming body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mo3, PDBe:7mo3, PDBj:7mo3
PDBsum	7mo3
PubMed	35679405
UniProt	P62826\|RAN_HUMAN GTP-binding nuclear protein Ran (Gene Name=RAN)

[Back to BioLiP]