Structure of PDB 7mk2 Chain A

Receptor sequence

>7mk2A (length=354) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

GPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSS
FFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSR
VRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRH
LLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEK
SLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKED
HTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMR
KEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVKHSLKGRLCVEIL
EQED

3D structure

PDB

7mk2 Structural basis of NPR1 in activating plant immunity.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C150 C155 H157 C160	C111 C116 H118 C121

Gene Ontology

	Molecular Function
GO:0003712	transcription coregulator activity
GO:0005515	protein binding
GO:0046872	metal ion binding
GO:1901149	salicylic acid binding

	Biological Process
GO:0001666	response to hypoxia
GO:0009408	response to heat
GO:0009611	response to wounding
GO:0009617	response to bacterium
GO:0009625	response to insect
GO:0009626	plant-type hypersensitive response
GO:0009627	systemic acquired resistance
GO:0009682	induced systemic resistance
GO:0009751	response to salicylic acid
GO:0009862	systemic acquired resistance, salicylic acid mediated signaling pathway
GO:0010112	regulation of systemic acquired resistance
GO:0016567	protein ubiquitination
GO:0031347	regulation of defense response
GO:0031348	negative regulation of defense response
GO:0042742	defense response to bacterium
GO:0045087	innate immune response
GO:0045893	positive regulation of DNA-templated transcription
GO:0050832	defense response to fungus
GO:0080027	response to herbivore
GO:0106167	extracellular ATP signaling
GO:1900424	regulation of defense response to bacterium
GO:2000022	regulation of jasmonic acid mediated signaling pathway
GO:2000031	regulation of salicylic acid mediated signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0016604	nuclear body
GO:0090575	RNA polymerase II transcription regulator complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mk2, PDBe:7mk2, PDBj:7mk2
PDBsum	7mk2
PubMed	35545668
UniProt	P93002\|NPR1_ARATH Regulatory protein NPR1 (Gene Name=NPR1)

[Back to BioLiP]