Structure of PDB 7mjx Chain A

Receptor sequence

>7mjxA (length=442) Species: 820 (Bacteroides uniformis)

DNKKLFIETYGCQMNVADSEVIASVMQMAGYSVADTLEEADAVFMNTCSI
RDNAEQKILNRLEFFHSLKKKKRGLIVGVLGCMAERVKDDLITNHHVDLV
VGPDAYLTLPELIASVEAGEKAMNVELSTTETYRDVIPSRICGNHISGFV
SIMRGCNNFCTYCIVPYTRGRERSRDVESILNEVADLVAKGYKEVTLLGQ
NVNSYRFEKPDGETITFPMLLRTVAEAAPGVRIRFTTSHPKDMSDETLQV
IADMPNVCKHIHLPVQSGSSRILKLMNRKYDREWYMDRVAAIRRIIPDCG
LSTDIFSGFHSETEEDHQLSLSLMEECGYDSAFMFKYSERPGTHASKHLP
DDVPEEVKIRRLNEIIALQNRLSAEANARCVGKTYEVLVEGVSKRSRDQL
FGRTEQNRVVVFDRGTHRVGDFVMVKVTESSSATLKGEEVAG

3D structure

• PDB: 7mjx Structural basis for tRNA methylthiolation by the radical SAM enzyme MiaB.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 2.8.4.3: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	G26 C27 Q28 C63 R66 N68 K72 T252 D319 F348 M349 F350 I381 K409 R410 R418 V424 S446 S447 A448 T449 K451	G11 C12 Q13 C48 R51 N53 K57 T237 D304 F333 M334 F335 I366 K394 R395 R403 V409 S431 S432 A433 T434 K436
BS02	F3S	A	C27 N30 C63 S64 I65 C97 R184 Q215	C12 N15 C48 S49 I50 C82 R169 Q200
BS03	SF4	A	C171 N173 C175 Y177 C178 V180 P181 R293	C156 N158 C160 Y162 C163 V165 P166 R278
BS04	MET	A	Q215 N216 T252 P279 R293	Q200 N201 T237 P264 R278

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016740 transferase activity
• GO:0035596 methylthiotransferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0035600 tRNA methylthiolation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7mjx, PDBe:7mjx, PDBj:7mjx
• PDBsum: 7mjx
• PubMed: 34526715
• UniProt: A0A174NUT3