Structure of PDB 7mjw Chain A

Receptor sequence

>7mjwA (length=441) Species: 820 (Bacteroides uniformis)

NKKLFIETYGCQMNVADSEVIASVMQMAGYSVADTLEEADAVFMNTCSIR
DNAEQKILNRLEFFHSLKKKKRGLIVGVLGCMAERVKDDLITNHHVDLVV
GPDAYLTLPELIASVEAGEKAMNVELSTTETYRDVIPSRICGNHISGFVS
IMRGCNNFCTYCIVPYTRGRERSRDVESILNEVADLVAKGYKEVTLLGQN
VNSYRFEKPDGETITFPMLLRTVAEAAPGVRIRFTTSHPKDMSDETLQVI
ADMPNVCKHIHLPVQSGSSRILKLMNRKYDREWYMDRVAAIRRIIPDCGL
STDIFSGFHSETEEDHQLSLSLMEECGYDSAFMFKYSERPGTHASKHLPD
DVPEEVKIRRLNEIIALQNRLSAEANARCVGKTYEVLVEGVSKRSRDQLF
GRTEQNRVVVFDRGTHRVGDFVMVKVTESSSATLKGEEVAG

3D structure

• PDB: 7mjw Structural basis for tRNA methylthiolation by the radical SAM enzyme MiaB.
• Chain: A
• Resolution: 1.4 Å

Enzymatic activity

• Enzyme Commision number: 2.8.4.3: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	G26 C27 Q28 C63 R66 N68 K72 T252 D319 F348 M349 F350 K409 R410 R418 V424 S446 S447 A448 T449	G10 C11 Q12 C47 R50 N52 K56 T236 D303 F332 M333 F334 K393 R394 R402 V408 S430 S431 A432 T433
BS02	ZKP	A	C27 N30 C63 S64 I65 C97 R184	C11 N14 C47 S48 I49 C81 R168
BS03	MET	A	Q215 N216 T252 H254 P279 R293	Q199 N200 T236 H238 P263 R277
BS04	SF4	A	C171 N173 C175 Y177 C178 V180 P181 R293	C155 N157 C159 Y161 C162 V164 P165 R277
BS05	MG	A	I266 M269 V272	I250 M253 V256

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016740 transferase activity
• GO:0035596 methylthiotransferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0035600 tRNA methylthiolation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7mjw, PDBe:7mjw, PDBj:7mjw
• PDBsum: 7mjw
• PubMed: 34526715
• UniProt: A0A174NUT3