Structure of PDB 7mic Chain A |
>7micA (length=144) Species: 59749 (Maize rayado fino virus) [Search protein sequence] |
EPDTARLDADPSASGPVMEFRELQKGAYIEPTGAFLTRARVSSSIPYPAR AACLLVAVSQATGLPTRTLWAALCANLPDSVLDDGSLATLGLTTDHFAVL ARIFSLRCRFVSEHGDVELGLHDATSRFTIRHTPGHFELVADNF |
|
PDB | 7mic The endopeptidase of the maize-affecting Marafivirus type member maize rayado fino virus doubles as a deubiquitinase. |
Chain | A |
Resolution | 2.09 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3CN |
A |
C61 G143 |
C53 G135 |
|
|
|
|