Structure of PDB 7m7s Chain A

Receptor sequence

>7m7sA (length=430) Species: 9606 (Homo sapiens)

GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGI
IAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASV
EVMEIMSRFAVIERAAIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYI
EGLPQGPEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEM
RAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQM
PIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYA
MCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEE
RLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGTEWSPPLTMLFLCATKFSAS

3D structure

• PDB: 7m7s Multiple deprotonation paths of the nucleophile 3'-OH in the DNA synthesis reaction.
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 K86 R93 K293 P316 K317 T318 G320 S322 K323 N324 P326 G327 R351	Q41 Y42 W45 K89 R96 K293 P316 K317 T318 G320 S322 K323 N324 P326 G327 R351
BS02	dna	A	R61 S257 G259 G260 K261 L262 R377 L381 R382	R64 S257 G259 G260 K261 L262 R377 L381 R382
BS03	DZ4	A	D15 C16 F17 F18 I48 A49 Y52 R55 D115 K231	D18 C19 F20 F21 I51 A52 Y55 R58 D118 K231
BS04	MG	A	D13 D115 E116	D16 D118 E119
BS05	DZ4	A	S257 K293 W297	S257 K293 W297

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:7m7s, PDBe:7m7s, PDBj:7m7s
• PDBsum: 7m7s
• PubMed: 34088846
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)