Structure of PDB 7m4e Chain A

Receptor sequence

>7m4eA (length=310) Species: 9606 (Homo sapiens)

NHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQ
MWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQ
KAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDS
LRQEGFLTDDLVKGETKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLY
FTGSAHFNRSMRALAKTKGMSLSEHALSTAVPGRVLPTPTEKDVFRLLGL
PYREPAERDW

3D structure

• PDB: 7m4e Watching right and wrong nucleotide insertion captures hidden polymerase fidelity checkpoints.
• Chain: A
• Resolution: 1.903 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.
  4.2.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	W274 V462 G464 E470 T471 K472 Y505 R517 K521	W24 V212 G214 E215 T216 K217 Y250 R262 K266
BS02	dna	A	W342 G343 G345 K347 T348 D427 D429 D490 Y505 F506 T507 G508 A510 N513	W92 G93 G95 K97 T98 D177 D179 D235 Y250 F251 T252 G253 A255 N258
BS03	dna	A	Y267 W274 R275 Y279 P303 G304 G306 M309 K312	Y17 W24 R25 Y29 P53 G54 G56 M59 K62
BS04	PPV	A	R386 G416 S417 R420 G426 D427	R136 G166 S167 R170 G176 D177
BS05	MG	A	D427 D429 D490	D177 D179 D235
BS06	MG	A	D427 D429	D177 D179
BS07	DCP	A	R386 G416 S417 R420 G426 D427 D429 Y505 G508 A510 N513	R136 G166 S167 R170 G176 D177 D179 Y250 G253 A255 N258

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:7m4e, PDBe:7m4e, PDBj:7m4e
• PDBsum: 7m4e
• PubMed: 35680862
• UniProt: Q9UGP5|DPOLL_HUMAN DNA polymerase lambda (Gene Name=POLL)