Structure of PDB 7m44 Chain A

Receptor sequence

>7m44A (length=312) Species: 9606 (Homo sapiens)

NHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQ
MWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQ
KAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDS
LRQEGFLTDDLVKGETKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLY
FTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRPGRVLPTPTEKDVFRLL
GLPYREPAERDW

3D structure

• PDB: 7m44 Watching right and wrong nucleotide insertion captures hidden polymerase fidelity checkpoints.
• Chain: A
• Resolution: 1.901 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.
  4.2.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	W274 V462 G464 T471 R514 R517 K521 L527 S528 E529 H530	W24 V212 G214 T216 R259 R262 K266 L272 S273 E274 H275
BS02	dna	A	W342 G343 A344 G345 K347 T348 D427 D429 R488 D490 Y505 F506 T507 G508 A510 N513	W92 G93 A94 G95 K97 T98 D177 D179 R233 D235 Y250 F251 T252 G253 A255 N258
BS03	dna	A	Y267 W274 R275 G278 Y279 G304 G306 R308 M309 K312	Y17 W24 R25 G28 Y29 G54 G56 R58 M59 K62
BS04	TTP	A	R386 G416 S417 R420 G426 D427 D429 Y505 G508 A510 N513	R136 G166 S167 R170 G176 D177 D179 Y250 G253 A255 N258
BS05	MG	A	D427 D429	D177 D179
BS06	MG	A	D427 D429 D490	D177 D179 D235
BS07	PPV	A	R386 G416 S417 R420 G426	R136 G166 S167 R170 G176

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:7m44, PDBe:7m44, PDBj:7m44
• PDBsum: 7m44
• PubMed: 35680862
• UniProt: Q9UGP5|DPOLL_HUMAN DNA polymerase lambda (Gene Name=POLL)