Structure of PDB 7m40 Chain A

Receptor sequence
>7m40A (length=401) Species: 9606 (Homo sapiens) [Search protein sequence]
FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPE
GKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGG
FGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKH
PSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDI
SAVPKGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTR
SNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKL
KLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPDA
EDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIY
N
3D structure
PDB7m40 Discovery of small molecule antagonists of human Retinoblastoma Binding Protein 4 (RBBP4)
ChainA
Resolution1.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 YQJ A R129 Y181 E231 E319 F321 R122 Y174 E223 E311 F313
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515 protein binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0031492 nucleosomal DNA binding
GO:0042393 histone binding
GO:0042826 histone deacetylase binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006260 DNA replication
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006335 DNA replication-dependent chromatin assembly
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0007420 brain development
GO:0008285 negative regulation of cell population proliferation
GO:0030336 negative regulation of cell migration
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
GO:0042659 regulation of cell fate specification
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:1902455 negative regulation of stem cell population maintenance
GO:1902459 positive regulation of stem cell population maintenance
GO:2000736 regulation of stem cell differentiation
Cellular Component
GO:0000118 histone deacetylase complex
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0016581 NuRD complex
GO:0016589 NURF complex
GO:0032991 protein-containing complex
GO:0033186 CAF-1 complex
GO:0035098 ESC/E(Z) complex
GO:0070822 Sin3-type complex
GO:1904949 ATPase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m40, PDBe:7m40, PDBj:7m40
PDBsum7m40
PubMed
UniProtQ09028|RBBP4_HUMAN Histone-binding protein RBBP4 (Gene Name=RBBP4)

[Back to BioLiP]