Structure of PDB 7lzf Chain A

Receptor sequence

>7lzfA (length=239) Species: 9606 (Homo sapiens)

GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKRMQCECTPL
SKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEV
ILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHY
YFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTK
LVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGEN

3D structure

• PDB: 7lzf Discovery of a First-in-Class Inhibitor of the Histone Methyltransferase SETD2 Suitable for Preclinical Studies.
• Chain: A
• Resolution: 2.47 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C1499 C1501 C1516 C1520	C45 C47 C62 C66
BS02	ZN	A	C1516 C1529 C1533 C1539	C62 C75 C79 C85
BS03	ZN	A	C1631 C1678 C1680 C1685	C177 C224 C226 C231
BS04	SAM	A	K1560 G1561 W1562 H1603 Y1604 Y1605 R1625 N1628 H1629 Q1676 C1678 F1679 L1689	K106 G107 W108 H149 Y150 Y151 R171 N174 H175 Q222 C224 F225 L235
BS05	YHV	A	Y1579 Y1604 F1606 H1629 F1664 Y1666 Y1671 G1672 E1674	Y125 Y150 F152 H175 F210 Y212 Y217 G218 E220

Gene Ontology

Molecular Function

• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046975 histone H3K36 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7lzf, PDBe:7lzf, PDBj:7lzf
• PDBsum: 7lzf
• PubMed: 34671445
• UniProt: Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)