Structure of PDB 7ls2 Chain A

Receptor sequence
>7ls2A (length=61) Species: 10090 (Mus musculus) [Search protein sequence]
DGFDSRGKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQST
LDEWKAIQNKD
3D structure
PDB7ls2 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A R188 R191 F193 D194 R195 H196 G198 R201 G203 L204 K205 K209 R210 S213 G214 H216 R6 R9 F11 D12 R13 H14 G16 R19 G21 L22 K23 K27 R28 S31 G32 H34
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0030371 translation repressor activity
GO:0032183 SUMO binding
GO:0043022 ribosome binding
GO:0061770 translation elongation factor binding
Biological Process
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
GO:0030578 PML body organization
GO:0141014 ribosome hibernation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls2, PDBe:7ls2, PDBj:7ls2
PDBsum7ls2
PubMed34815424
UniProtQ9CY58|SERB1_MOUSE SERPINE1 mRNA-binding protein 1 (Gene Name=Serbp1)

[Back to BioLiP]