Structure of PDB 7lnu Chain A

Receptor sequence

>7lnuA (length=239) Species: 1291540 (Methanomethylophilus alvi)

SHMILIKLGGSVITDKSEYHKFNKETVSRLADEIRRSGQDVMVVHGAGSF
GHVIAKKYAIQDGHVDDGQIPAAARIMCDTRELSSMVVEELLAQGIPAVS
VAPGSCFVMEDGKLIVDNEEPIRRLADLGIMPVMFGDVVPDRKKGFAIVS
GDQCMEVLCRMFDPEKVVFVSDIDGLYTADPKTDKKARLIGEVTSKMEAM
LRMTDRNRRCYLVNGNAPNRLYSLLKGETVTCTVAKGGM

3D structure

• PDB: 7lnu Molecular Basis for the Substrate Promiscuity of Isopentenyl Phosphate Kinase from Candidatus methanomethylophilus alvus .
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.26: isopentenyl phosphate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IP8	A	G44 A45 G49 H50 G134 I146 S148 G149	G46 A47 G51 H52 G136 I148 S150 G151
BS02	ADP	A	G7 G8 S9 K14 D170 I171 L174 D178 K180	G9 G10 S11 K16 D172 I173 L176 D180 K182
BS03	ATP	A	K5 G7 G8 S9 K14 D170 L174 A177 D178 K180	K7 G9 G10 S11 K16 D172 L176 A179 D180 K182
BS04	IPE	A	A45 G49 H50 G134 I146 G149	A47 G51 H52 G136 I148 G151

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0102043 isopentenyl phosphate kinase activity

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:7lnu, PDBe:7lnu, PDBj:7lnu
• PDBsum: 7lnu
• PubMed: 34905349
• UniProt: M9SEQ1