Structure of PDB 7lhr Chain A

Receptor sequence

>7lhrA (length=214) Species: 1773 (Mycobacterium tuberculosis)

TTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIWTTCNYVVASN
MADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESVYDVRVLNVT
PEHTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRV
DAPTRANAPLVSFDETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVRE
GYPSIGCAPCTAKP

3D structure

• PDB: 7lhr Crystal Structure of the [4Fe-4S] Cluster-Containing Adenosine-5'-phosphosulfate Reductase from Mycobacterium tuberculosis .
• Chain: A
• Resolution: 3.11 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V214 Y218
• Catalytic site (residue number reindexed from 1): V198 Y202
• Enzyme Commision number: 1.8.4.10: adenylyl-sulfate reductase (thioredoxin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	Y92 F133 P137 C140 C141 C223 C226	Y76 F117 P121 C124 C125 C207 C210

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity
• GO:0016491 oxidoreductase activity
• GO:0043866 adenylyl-sulfate reductase (thioredoxin) activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0019344 cysteine biosynthetic process
• GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:7lhr, PDBe:7lhr, PDBj:7lhr
• PDBsum: 7lhr
• PubMed: 34095667
• UniProt: P9WIK3|CYSH_MYCTU Adenosine 5'-phosphosulfate reductase (Gene Name=cysH)