Structure of PDB 7lho Chain A

Receptor sequence
>7lhoA (length=133) Species: 9606 (Homo sapiens) [Search protein sequence]
TRDANGTWEMESNENFEGWMKALDIDFALRKIAVRLTQTLVIDQDGDNFK
VKCTSTFWNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGE
KENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK
3D structure
PDB7lho Crystal structure of Q108K:K40L:T51V:T53C:R58W:T29L:Y19W:Q4A mutant of cellular retinol binding protein II complex with all-trans-retinal in the dark
ChainA
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 RET A F16 W19 A33 Q38 C53 W58 Y60 W106 K108 L117 F16 W19 A33 Q38 C53 W58 Y60 W106 K108 L117
Gene Ontology
Molecular Function
GO:0005501 retinoid binding
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0016918 retinal binding
GO:0019841 retinol binding
Biological Process
GO:0006776 vitamin A metabolic process
GO:0008544 epidermis development
GO:0015908 fatty acid transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lho, PDBe:7lho, PDBj:7lho
PDBsum7lho
PubMed
UniProtP50120|RET2_HUMAN Retinol-binding protein 2 (Gene Name=RBP2)

[Back to BioLiP]