Structure of PDB 7lai Chain A |
>7laiA (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] |
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKI FLQKVASMPQEEQELVVTIP |
|
PDB | 7lai Differential BET Bromodomain Inhibition by Dihydropteridinone and Pyrimidodiazepinone Kinase Inhibitors. |
Chain | A |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
R78 |
A |
V103 Y155 N156 I162 |
V31 Y83 N84 I90 |
|
|
|