Structure of PDB 7l1k Chain A

Receptor sequence
>7l1kA (length=149) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
MVTIVPYSHQYLKDICQLIQKDLSEPYSKYVYRYFVHQWPEFSFVALDND
RFIGAVICKQDVHRGTTLRGYIAMLAIVKEYRGQGIATKLTQASLDVMKN
RGAQEIVLETEVDNEAAMSFYERLGFCRYKRLYRYYLNGTDAFRYILYP
3D structure
PDB7l1k Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
ChainA
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.256: N-terminal methionine N(alpha)-acetyltransferase NatC.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E25 Y27 F35 A73 E109 Y135 Y136 E25 Y27 F35 A73 E109 Y135 Y136
BS02 IHP A H63 R64 R69 K130 R144 H63 R64 R69 K130 R144
BS03 CMC A L23 L75 I77 R82 G83 G85 I86 T88 A116 A117 S119 F120 R123 L23 L75 I77 R82 G83 G85 I86 T88 A116 A117 S119 F120 R123
Gene Ontology
Molecular Function
GO:0000822 inositol hexakisphosphate binding
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity
Biological Process
GO:0017196 N-terminal peptidyl-methionine acetylation
GO:0051604 protein maturation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031417 NatC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7l1k, PDBe:7l1k, PDBj:7l1k
PDBsum7l1k
PubMed34019809
UniProtO74311|NAA30_SCHPO N-alpha-acetyltransferase 30 (Gene Name=naa30)

[Back to BioLiP]