Structure of PDB 7ktj Chain A

Receptor sequence

>7ktjA (length=328) Species: 9606 (Homo sapiens)

WMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVL
KALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQT
MKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLIT
HPKEGQEAGLLPRVMCRLQDQGLILYHQHAFERSFCIFRLPQPGSWKAVR
VDLVVAPVSQFPFALLGWTGSDLFQRELRRFSRKEKGLWLNSHGLFDPEQ
KTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7ktj Watching a double strand break repair polymerase insert a pro-mutagenic oxidized nucleotide.
• Chain: A
• Resolution: 1.452 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G174 L177 Q364 F385 E386 R387 R442 R445 R449 K450 N457 H459	G38 L41 Q228 F231 E232 R233 R276 R279 R283 K284 N291 H293
BS02	dna	A	G245 V246 G247 K249 T250 H329 R416	G109 V110 G111 K113 T114 H193 R250
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G38 R39 T42 F43 H68 G70 H72 S73
BS04	CA	A	D330 D332 D418	D194 D196 D252
BS05	CA	A	D330 D332	D194 D196
BS06	CA	A	T241 I243 V246	T105 I107 V110
BS07	8DG	A	G320 R323 K325 G328 H329 D330 D332 G433 G436 D438	G184 R187 K189 G192 H193 D194 D196 G267 G270 D272

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7ktj, PDBe:7ktj, PDBj:7ktj
• PDBsum: 7ktj
• PubMed: 33824325
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)