Structure of PDB 7ktf Chain A

Receptor sequence

>7ktfA (length=327) Species: 9606 (Homo sapiens)

WMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVL
KALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQT
MKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLIT
HPKEGQEAGLLPRVMCRLQDQGLILYHQAFERSFCIFRLPQPGSWKAVRV
DLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQK
TFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7ktf Watching a double strand break repair polymerase insert a pro-mutagenic oxidized nucleotide.
• Chain: A
• Resolution: 1.489 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 F385 E386 R387 R442 R445 R449 K450 L456 N457 H459	L41 F230 E231 R232 R275 R278 R282 K283 L289 N290 H292
BS02	dna	A	G245 V246 G247 T250 D330 D332 F389 R416 D418 W434 G436 K438 R445	G109 V110 G111 T114 D194 D196 F234 R249 D251 W267 G269 K271 R278
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G38 R39 T42 F43 H68 G70 H72 S73
BS04	MG	A	D330 D332	D194 D196
BS05	MG	A	D330 D332 D418	D194 D196 D251

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7ktf, PDBe:7ktf, PDBj:7ktf
• PDBsum: 7ktf
• PubMed: 33824325
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)