Structure of PDB 7kt6 Chain A

Receptor sequence

>7kt6A (length=325) Species: 9606 (Homo sapiens)

MPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLK
ALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTM
KLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLS
TPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITH
PKEGQEAGLLPRVMCRLQDQGLILYHQFERSFCIFRLPQPGSWKAVRVDL
VVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQKTF
FQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7kt6 Watching a double strand break repair polymerase insert a pro-mutagenic oxidized nucleotide.
• Chain: A
• Resolution: 1.87 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 F385 E386 R387 R442 R445 R449 K450 L456 N457	L40 F228 E229 R230 R273 R276 R280 K281 L287 N288
BS02	dna	A	G245 V246 G247 T250 D330 D332 F389 R416 D418 G433 W434 G436 K438	G108 V109 G110 T113 D193 D195 F232 R247 D249 G264 W265 G267 K269
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G37 R38 T41 F42 H67 G69 H71 S72
BS04	MN	A	D330 D332	D193 D195
BS05	MN	A	D330 D332 D418	D193 D195 D249
BS06	MN	A	N457 S458 H459	N288 S289 H290
BS07	MN	A	E386 H459	E229 H290
BS08	GOA	A	G319 G320 R323	G182 G183 R186

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7kt6, PDBe:7kt6, PDBj:7kt6
• PDBsum: 7kt6
• PubMed: 33824325
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)