Structure of PDB 7ksy Chain A

Receptor sequence

>7ksyA (length=327) Species: 9606 (Homo sapiens)

WMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVL
KALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQT
MKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLIT
HPKEGQEAGLLPRVMCRLQDQGLILYHQAFERSFCIFRLPQPGSWKAVRV
DLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQK
TFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 7ksy Watching a double strand break repair polymerase insert a pro-mutagenic oxidized nucleotide.
• Chain: A
• Resolution: 1.577 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 Q364 F385 E386 R387 R442 R445 R449 K450 L456 N457 H459	L41 Q228 F230 E231 R232 R275 R278 R282 K283 L289 N290 H292
BS02	dna	A	G245 V246 G247 K249 T250 D330 D332 F389 R416 D418 G433 W434 T435 G436 K438 R445	G109 V110 G111 K113 T114 D194 D196 F234 R249 D251 G266 W267 T268 G269 K271 R278
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G38 R39 T42 F43 H68 G70 H72 S73
BS04	MG	A	D330 D332	D194 D196
BS05	GOA	A	G319 G320 R323 D330	G183 G184 R187 D194

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7ksy, PDBe:7ksy, PDBj:7ksy
• PDBsum: 7ksy
• PubMed: 33824325
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)