Structure of PDB 7kpq Chain A

Receptor sequence

>7kpqA (length=383) Species: 5077 (Penicillium citrinum)

QQINVIIVGLGIAGLTAAIECHRKGHKVIAFEKTPKMMHIGDIFSIGPNA
ESVIRQWKDGAISRALNEARCAIDEIKVFDETGKLQNVEGYVINRAEAVD
IFFEYAQSLGIDIRFNSNVTEYWETPHNAGIIVDGLKIEADCVIATDGIH
SKARNAICGAVVQPKKTGSAIYRSGYAMEELRGHSGAVWLTEGKEDVDQL
YHFIGKDITVLVGTGRRGKDVYWGCMHKSLHDVSESWIQVSDVRRAIELI
SDWNVRDRLEPIMACTPQGKCFDHLVMTMDQLPSWVSPKHRMIVLGDAAH
PFLPNTGQGANQAIEDGATVAICLELAGKNQVTKGVQVAERLRYQRVAKI
QELGHRMLKPAWIYSHDCQQYAYNEFQTVAQLV

3D structure

• PDB: 7kpq Structural basis of the stereoselective formation of the spirooxindole ring in the biosynthesis of citrinadins.
• Chain: A
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G27 G29 I30 A31 E50 K51 I58 D60 F62 R122 S144 V146 D174 G175 W264 G323 D324 A337	G9 G11 I12 A13 E32 K33 I40 D42 F44 R95 S117 V119 D147 G148 W237 G296 D297 A310

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 08:10:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7kpq', asym_id = 'A', title = 'Structural basis of the stereoselective formatio...oxindole ring in the biosynthesis of citrinadins.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7kpq', asym_id='A', title='Structural basis of the stereoselective formatio...oxindole ring in the biosynthesis of citrinadins.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0071949', uniprot = '', pdbid = '7kpq', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0071949', uniprot='', pdbid='7kpq', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>