Structure of PDB 7kld Chain A

Receptor sequence
>7kldA (length=100) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MITVDITVNDEGKVTDVIMDGHAHDIVCAGASAVLFGSVNAIIGLTSERP
DINYDDNGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNENIRLNYK
3D structure
PDB7kld Phage-Related Ribosomal Protease (Prp) of Staphylococcus aureus : In Vitro Michaelis-Menten Kinetics, Screening for Inhibitors, and Crystal Structure of a Covalent Inhibition Product Complex.
ChainA
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.22.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A I2 M19 H22 A23 H30 D31 C34 A35 S38 F42 G64 H66 I2 M19 H22 A23 H24 D25 C28 A29 S32 F36 G58 H60
BS02 CA A N104 Y105 N98 Y99
BS03 CA A L51 E78 L45 E72
BS04 CA A D57 N59 D51 N53
BS05 CA A E94 N98 I101 E88 N92 I95
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0042254 ribosome biogenesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kld, PDBe:7kld, PDBj:7kld
PDBsum7kld
PubMed35731716
UniProtQ2FXS9|PRP_STAA8 Ribosomal processing cysteine protease Prp (Gene Name=prp)

[Back to BioLiP]