Structure of PDB 7kii Chain A

Receptor sequence

>7kiiA (length=103) Species: 257468 (Muscovy duck circovirus) [Search protein sequence]

SGNYSYKRWVFTINNPTFEDYVHVLEFCTLDNCKFAIVGEEKGANGTPHL
QGFLNLRSNARAAALEESLGGRAWLSRARGSDEDNEEFCAKESTYLRVGE
PVS

3D structure

PDB

7kii Muscovy duck circovirus Rep domain complexed with a single-stranded DNA 10-mer comprising the cleavage site and Mn2+

Chain

Resolution

1.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	S4 Y7 V13 T15 N17 N18 G46 A47 N48 T50 Q54 A65 A66 E69 G74 R75 A76 W77 L78 S79 A81 R82 G83 D87 N88 F91 K94	S1 Y4 V10 T12 N14 N15 G43 A44 N45 T47 Q51 A62 A63 E66 G71 R72 A73 W74 L75 S76 A78 R79 G80 D84 N85 F88 K91
BS02	MN	A	E44 H52 Q54	E41 H49 Q51
BS03	CA	A	Y9 K10 R11	Y6 K7 R8
BS04	CA	A	T20 F21 E22	T17 F18 E19

Gene Ontology

	Biological Process
GO:0006260	DNA replication

External links