Structure of PDB 7kbe Chain A

Receptor sequence
>7kbeA (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB7kbe Structural features of nucleosomes in interphase and metaphase chromosomes.
ChainA
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R42 P43 T45 R72 R83 F84 V117 R6 P7 T9 R36 R47 F48 V81
BS02 dna A R40 G44 V46 R49 K64 L65 P66 R69 R83 R4 G8 V10 R13 K28 L29 P30 R33 R47
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7kbe, PDBe:7kbe, PDBj:7kbe
PDBsum7kbe
PubMed34478647
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]