Structure of PDB 7k9y Chain A

Receptor sequence

>7k9yA (length=425) Species: 1422 (Geobacillus stearothermophilus)

ALLERILARDNLITALKRVEANQGAPGIDGVSTDQLRDYIRAHWSTIHAQ
LLAGTYRPAPVRRVEIPKPGGGTRQLGIPTVVDRLIQQAILQELTPIFDP
DFSSSSFGFRPGRNAHDAVRQAQGYIQEGYRYVVDMDLEKFFDRVNHDIL
MSRVARKVKDKRVLKLIRAYLQAGVMIEGVKVQTEEGTPQGGPLSPLLAN
ILLDDLDKELEKRGLKFCRYADDCNIYVKSLRAGQRVKQSIQRFLEKTLK
LKVNEEKSAVDRPWKRAFLGFSFTPERKARIRLAPRSIQRLKQRIRQLTN
PNWSISMPERIHRVNQYVMGWIGYFRLVETPSVLQTIEGWIRRRLRLCQW
LQWKRVRTRIRELRALGLKETAVMEIANTRKGAWRTTKTPQLHQALGKTY
WTAQGLKSLTQRYFELRQGHHHHHH

3D structure

• PDB: 7k9y Structural basis for template switching by a group II intron-encoded non-LTR-retroelement reverse transcriptase.
• Chain: A
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K18 Q24 Y221 Q317 Y318 G321 Y325	K17 Q23 Y220 Q316 Y317 G320 Y324
BS02	rna	A	R19 F110 R111 P112 G113 N115 P194 P197	R18 F109 R110 P111 G112 N114 P193 P196
BS03	rna	A	N23 G25 A26 R63 V65 I67 I79 R85 G192 G193 P194 P197	N22 G24 A25 R62 V64 I66 I78 R84 G191 G192 P193 P196
BS04	rna	A	R281 S333	R280 S332
BS05	DTP	A	K69 R75 D138 L139 E140 K141 F142 F143 D223 K258	K68 R74 D137 L138 E139 K140 F141 F142 D222 K257
BS06	MG	A	D138 L139 D223	D137 L138 D222

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003964 RNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006278 RNA-templated DNA biosynthetic process
• GO:0006974 DNA damage response
• GO:0051607 defense response to virus

External links

• PDB: RCSB:7k9y, PDBe:7k9y, PDBj:7k9y
• PDBsum: 7k9y
• PubMed: 34280434
• UniProt: E2GM63