Structure of PDB 7k62 Chain A

Receptor sequence

>7k62A (length=165) Species: 1768 (Mycobacterium kansasii)

HHHHHHMVGLIWAQSTSGVIGRGGDIPWRVPEDLSHFKRITMGHTVVMGR
RTWDSLPASARPLPGRRNVVLSRQPGFVAEGAEVVGSLEDALTGPEDTWV
IGGEQIYTLALPRAIRCEVTEVDVDLPRDDDDALAPPLDETWQGDVGEWQ
VSRSGLRYRFHSYYR

3D structure

• PDB: 7k62 Crystal Structure of Dihydrofolate reductase from Mycobacterium kansasii in complex with NADP and inhibitor P218
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): I4 I19 W21 D26 L27 F30 L56 T91 T113
• Catalytic site (residue number reindexed from 1): I11 I26 W28 D33 L34 F37 L63 T98 T120
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	W5 A6 I13 G17 D18 G42 R43 R44 T45 L64 S65 R66 Q67 G79 I94 G95 G96 E97 Q98 I99 A126	W12 A13 I20 G24 D25 G49 R50 R51 T52 L71 S72 R73 Q74 G86 I101 G102 G103 E104 Q105 I106 A133
BS02	MMV	A	I4 W5 A6 D26 L27 F30 K31 L49 P50 L56 R59 I94	I11 W12 A13 D33 L34 F37 K38 L56 P57 L63 R66 I101

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:7k62, PDBe:7k62, PDBj:7k62
• PDBsum: 7k62
• UniProt: A0A653EQ34