Structure of PDB 7k5d Chain A |
>7k5dA (length=123) Species: 128952 (Ebola virus - Mayinga, Zaire, 1976) [Search protein sequence] |
VSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLA SYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQL PQYFTFDLTALKLITQPLPAATW |
|
PDB | 7k5d Cellular mRNA triggers structural transformation of Ebola virus matrix protein VP40 to its essential regulatory form. |
Chain | A |
Resolution | 1.78 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
F125 G126 R134 |
F57 G58 R66 |
|
|
|