Structure of PDB 7gat Chain A

Receptor sequence
>7gatA (length=66) Species: 162425 (Aspergillus nidulans) [Search protein sequence]
MKNGEQNGPTTCTNCFTQTTPVWRRNPEGQPLCNACGLFLKLHGVVRPLS
LKTDVIKKRNRNSANS
3D structure
PDB7gat The solution structure of the Leu22-->Val mutant AREA DNA binding domain complexed with a TGATAG core element defines a role for hydrophobic packing in the determination of specificity.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P21 N34 F39 H43 R47 R61 N62 S63 P21 N34 F39 H43 R47 R61 N62 S63 PDBbind-CN: Kd=3.1uM
BS02 ZN A C12 C15 C33 C36 C12 C15 C33 C36
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7gat, PDBe:7gat, PDBj:7gat
PDBsum7gat
PubMed9533884
UniProtP17429|AREA_EMENI Nitrogen regulatory protein areA (Gene Name=areA)

[Back to BioLiP]