Structure of PDB 7fzy Chain A

Receptor sequence

>7fzyA (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]

SHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGD
VITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKW
DGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA

3D structure

PDB

7fzy Crystal Structure of a human FABP4 complex

Chain

Resolution

1.17 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	65X	A	F16 M20 A33 A36 P38 M40 S53 S55 A75 D76 R106 V115 R126 Y128	F19 M23 A36 A39 P41 M43 S56 S58 A78 D79 R109 V118 R129 Y131

Gene Ontology

	Molecular Function
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0051427	hormone receptor binding

	Biological Process
GO:0009617	response to bacterium
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0042632	cholesterol homeostasis
GO:0045892	negative regulation of DNA-templated transcription
GO:0050729	positive regulation of inflammatory response
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0071285	cellular response to lithium ion
GO:0071356	cellular response to tumor necrosis factor
GO:0120162	positive regulation of cold-induced thermogenesis

External links

PDB	RCSB:7fzy, PDBe:7fzy, PDBj:7fzy
PDBsum	7fzy
PubMed
UniProt	P15090\|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)