Structure of PDB 7fyp Chain A |
>7fypA (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
HMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDV ITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWD GKSTTIKRKREDDKLVVECVMKGVTSTRVYERA |
|
PDB | 7fyp Crystal Structure of a human FABP4 complex |
Chain | A |
Resolution | 1.12 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
W95 |
A |
F16 R126 Y128 |
F18 R128 Y130 |
|
|
|
|