Structure of PDB 7fyj Chain A

Receptor sequence

>7fyjA (length=135) Species: 9606 (Homo sapiens) [Search protein sequence]

GSHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNG
DVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQK
WDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA

3D structure

PDB

7fyj Crystal Structure of a human FABP4 complex

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	W7Z	A	W8 F16 M20 M40 I42 I51 A75 D76 R106 V115 R126 Y128	W12 F20 M24 M44 I46 I55 A79 D80 R110 V119 R130 Y132

Gene Ontology

	Molecular Function
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0051427	hormone receptor binding

	Biological Process
GO:0009617	response to bacterium
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0042632	cholesterol homeostasis
GO:0045892	negative regulation of DNA-templated transcription
GO:0050729	positive regulation of inflammatory response
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0071285	cellular response to lithium ion
GO:0071356	cellular response to tumor necrosis factor
GO:0120162	positive regulation of cold-induced thermogenesis

External links

PDB	RCSB:7fyj, PDBe:7fyj, PDBj:7fyj
PDBsum	7fyj
PubMed
UniProt	P15090\|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)