Structure of PDB 7fdx Chain A |
>7fdxA (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDIL TLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDG QETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
|
PDB | 7fdx X-ray structure of the human heart fatty acid-binding protein complexed with the fluorescent probe 8-Anilino-1-naphthalenesulfonic acid (ANS) |
Chain | A |
Resolution | 0.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2AN |
A |
S55 A75 D76 |
S56 A76 D77 |
|
|
|
|